PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G24040.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 183aa    MW: 20764.8 Da    PI: 10.0232
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G24040.6genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF85.14.1e-271766251
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     rie+ + rqv fskRr g++KKA+ELSvLCda+va+++fs+ g+lye++s
  ORUFI08G24040.6 17 RIEDRTSRQVRFSKRRSGLFKKAYELSVLCDAQVALLVFSPAGRLYEFAS 66
                     8***********************************************86 PP

2K-box17.32e-071281704385
            K-box  43 LesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85 
                      +++L++ eL+ Le+++ ++l+ +++k +  + + + ++ kk k
  ORUFI08G24040.6 128 VNELNIAELRGLEEAMTNALTVVKNKLMMQVASVLPQSEKKRK 170
                      799********************99988888877777777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-35867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.291868IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.19E-291086IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-281030IPR002100Transcription factor, MADS-box
CDDcd002658.45E-321378No hitNo description
PfamPF003193.0E-261764IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-283045IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-284566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MEGGGRRRKR GKVELRRIED RTSRQVRFSK RRSGLFKKAY ELSVLCDAQV ALLVFSPAGR  60
LYEFASSTSS IDTIFGRYWD LLDTTIDLNI EARESRVDCN IQLRQKERSD DPVPKINHIT  120
QCVLESNVNE LNIAELRGLE EAMTNALTVV KNKLMMQVAS VLPQSEKKRK SCSISEPRSG  180
VSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-1710101384Myocyte-specific enhancer factor 2B
1tqe_R1e-1710101384Myocyte-specific enhancer factor 2B
1tqe_Q1e-1710101384Myocyte-specific enhancer factor 2B
1tqe_P1e-1710101384Myocyte-specific enhancer factor 2B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1512RRRKRGKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2429800.0AK242980.1 Oryza sativa Japonica Group cDNA, clone: J090094F15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649438.11e-132PREDICTED: agamous-like MADS-box protein AGL3 isoform X2
TrEMBLA0A0E0QLM41e-133A0A0E0QLM4_ORYRU; Uncharacterized protein
STRINGLOC_Os08g41960.11e-131(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.35e-28MIKC_MADS family protein